KIF16B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214157

Catalog No. NBP214157

Description

KIF16B Polyclonal specifically detects KIF16B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KIF16B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: C20orf23, chromosome 20 open reading frame 23, dJ971B4.1, FLJ20135, KIAA1590, kinesin family member 16B, kinesin-like protein KIF16B, KISC20ORF, SNX23kinesin motor protein, sorting nexin 23, Sorting nexin-23
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KIF16B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEYRLQYKERQLQYLLQNHLPTLLEEKQ
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55614
• Target Species: Human
• Isotype: IgG

For Research Use Only