Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIF19 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15816820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15816820 20 μL
NBP158168 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15816820 Supplier Novus Biologicals Supplier No. NBP15816820UL

Rabbit Polyclonal Antibody

KIF19 Polyclonal specifically detects KIF19 in Human samples. It is validated for Western Blot.

Specifications

Antigen KIF19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q8N1X8
Gene Alias FLJ37300, KIF19A, kinesin family member 19, kinesin-like protein KIF19
Gene Symbols KIF19
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FLJ37300 The peptide sequence was selected from the N terminal of FLJ37300. Peptide sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 124602
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.