Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIF19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15816820UL
Description
KIF19 Polyclonal specifically detects KIF19 in Human samples. It is validated for Western Blot.Specifications
KIF19 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8N1X8 | |
KIF19 | |
Synthetic peptides corresponding to FLJ37300 The peptide sequence was selected from the N terminal of FLJ37300. Peptide sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FLJ37300, KIF19A, kinesin family member 19, kinesin-like protein KIF19 | |
Rabbit | |
Affinity Purified | |
RUO | |
124602 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction