Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIF19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	KIF19
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15816820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15816820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP158168 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP158168	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

KIF19 Polyclonal specifically detects KIF19 in Human samples. It is validated for Western Blot.

Specifications

Antigen	KIF19
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q8N1X8
Gene ID (Entrez)	124602
Immunogen	Synthetic peptides corresponding to FLJ37300 The peptide sequence was selected from the N terminal of FLJ37300. Peptide sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	FLJ37300, KIF19A, kinesin family member 19, kinesin-like protein KIF19
Gene Symbols	KIF19
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

KIF19 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents