KIF1A Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP180033	100 μL

Catalog No. NBP180033 Supplier Novus Biologicals Supplier No. NBP180033

Description

Rabbit Polyclonal Antibody

KIF1A Polyclonal specifically detects KIF1A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KIF1A
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: NP_004312
• Gene Alias: heavy chain, member 1A, homolog of mouse, kinesin family member 1A, unc-104- and KIF1A-related protein
• Gene Symbols: KIF1A
• Host Species: Rabbit
• Immunogen: Synthetic peptide directed towards the N terminal of human KIF1A. Peptide sequence TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 547
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Chicken: 92%; Zebrafish: 78%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only