KIFC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158178

Catalog No. NBP158178

Description

KIFC3 Polyclonal specifically detects KIFC3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KIFC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686D23201, FLJ34694, kinesin family member C3, kinesin-like protein KIFC3
• Host Species: Rabbit
• Molecular Weight of Antigen: 93 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 92%; Mouse: 92%; Rat: 92%; Bovine: 85%; Canine: 85%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BVG8
• Gene Symbols: KIFC3
• Immunogen: Synthetic peptides corresponding to KIFC3(kinesin family member C3) The peptide sequence was selected from the C terminal of KIFC3 (NP_005541). Peptide sequence EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3801
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.