Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Kinesin 5C Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Kinesin 5C Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB123553 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB123553 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB123553 Supplier Novus Biologicals Supplier No. NBP309326100UL

Description

Rabbit Polyclonal Antibody

Kinesin 5C Polyclonal specifically detects Kinesin 5C in Human, Mouse samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

Antigen Kinesin 5C
Applications Western Blot, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunoprecipitation
Formulation PBS buffer, 2% sucrose
Gene Alias heavy chain, neuron-specific, KIF 5C, kinesin family member 5C, Kinesin heavy chain neuron-specific 2, MGC111478, NKHC, NKHC2NKHC-2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human Kinesin 5C (NP_004513). Peptide sequence ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Biology, Cellular Markers
Primary or Secondary Primary
Gene ID (Entrez) 3800
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.