Kinesin C2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158247

Catalog No. NBP158247

Description

Kinesin C2 Polyclonal specifically detects Kinesin C2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kinesin C2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: kinesin family member C2, kinesin-like protein KIFC2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 85%; Equine: 85%; Mouse: 78%.
• Target Species: Human, Mouse, Bovine, Equine
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q96AC6
• Gene Symbols: KIFC2
• Immunogen: Synthetic peptides corresponding to KIFC2 (kinesin family member C2) The peptide sequence was selected from the N terminal of KIFC2. Peptide sequence VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE.
• Quantity: 100 μL
• Research Discipline: Cytoskeleton Markers, Vision
• Gene ID (Entrez): 90990
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG