Learn More
Description
Specifications
Specifications
| Antigen | Kininogen |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS, 2% Sucrose |
| Gene Alias | Alpha-2-thiol proteinase inhibitor, BDK, bradykinin, Fitzgerald factor, High molecular weight kininogen, kininogen, kininogen 1, kininogen-1, KNGHMWK, Williams-Fitzgerald-Flaujeac factor |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human Kininogen. Peptide sequence: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK The peptide sequence for this immunogen was taken from within the described region. |
| Purification Method | Immunogen affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
