Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kininogen Antibody, Novus Biologicals™
SDP

Catalog No. NBP153176 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP153176 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP153176 Supplier Novus Biologicals Supplier No. NBP153176

Rabbit Polyclonal Antibody

Kininogen Polyclonal specifically detects Kininogen in Human samples. It is validated for Western Blot.

Specifications

Antigen Kininogen
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P01042
Gene Alias Alpha-2-thiol proteinase inhibitor, BDK, bradykinin, Fitzgerald factor, High molecular weight kininogen, kininogen, kininogen 1, kininogen-1, KNGHMWK, Williams-Fitzgerald-Flaujeac factor
Gene Symbols KNG1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Kininogen. The peptide sequence was selected from the middle region. Peptide sequence YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3827
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Pig: 92%; Equine: 84%; Mouse: 76%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Pig, Equine
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.