Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KIR2DL4/CD158d Antibody, Novus Biologicals™
SDP

Catalog No. NBP154605 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154605 100 μL
NBP15460520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP154605 Supplier Novus Biologicals Supplier No. NBP154605
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

KIR2DL4/CD158d Polyclonal specifically detects KIR2DL4/CD158d in Human samples. It is validated for Western Blot.

Specifications

Antigen KIR2DL4/CD158d
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8NHK1
Gene Alias 103AS, 15.212, CD158 antigen-like family member D, CD158d antigen, CD158DKIR103ASKiller cell inhibitory receptor 103AS, G9P, killer cell immunoglobulin-like receptor 2DL4, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4, killer Ig receptor, KIR103, KIR-103AS, MHC class I NK cell receptor KIR103AS, natural killer cell inhibitory receptor, NK cell receptor
Gene Symbols KIR2DL4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KIR2DL4(killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4) The peptide sequence was selected from the middle region of KIR2DL4. Peptide sequence VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3805
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.