KIR2DL4/CD158d Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154605

Catalog No. NBP154605

Description

KIR2DL4/CD158d Polyclonal specifically detects KIR2DL4/CD158d in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KIR2DL4/CD158d
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 103AS, 15.212, CD158 antigen-like family member D, CD158d antigen, CD158DKIR103ASKiller cell inhibitory receptor 103AS, G9P, killer cell immunoglobulin-like receptor 2DL4, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4, killer Ig receptor, KIR103, KIR-103AS, MHC class I NK cell receptor KIR103AS, natural killer cell inhibitory receptor, NK cell receptor
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 3805
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NHK1
• Gene Symbols: KIR2DL4
• Immunogen: Synthetic peptides corresponding to KIR2DL4(killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4) The peptide sequence was selected from the middle region of KIR2DL4. Peptide sequence VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.