Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIR2DL5B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | KIR2DL5B |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB123861
|
Novus Biologicals
NBP309480100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
KIR2DL5B Polyclonal specifically detects KIR2DL5B in Human samples. It is validated for Western Blot.Specifications
KIR2DL5B | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
5B, CD158 antigen-like family member F2, CD158F, CD158F2, CD158f2 antigen, killer cell immunoglobulin-like receptor 2DL5B, Killer cell immunoglobulin-like receptor 2DLX, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, KIR2DL5.2, KIR2DL5.3, KIR2DL5.4, KIR2DL5killer cell Ig-like receptor, KIR2DLX | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5B (NP_001018091). Peptide sequence DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
553128 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title