Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIR2DL5B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | KIR2DL5B |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
KIR2DL5B Polyclonal specifically detects KIR2DL5B in Human samples. It is validated for Western Blot.Specifications
| KIR2DL5B | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 5B, CD158 antigen-like family member F2, CD158F, CD158F2, CD158f2 antigen, killer cell immunoglobulin-like receptor 2DL5B, Killer cell immunoglobulin-like receptor 2DLX, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, KIR2DL5.2, KIR2DL5.3, KIR2DL5.4, KIR2DL5killer cell Ig-like receptor, KIR2DLX | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR2DL5B (NP_001018091). Peptide sequence DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 553128 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title