Kir3.4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18808225UL

Catalog No. NB418320

Description

Kir3.4 Polyclonal specifically detects Kir3.4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kir3.4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Cardiac inward rectifier, CIRKIR3.4, G protein-activated inward rectifier potassium channel 4, GIRK-4, GIRK4Kir3.4, Heart KATP channel, Inward rectifier K(+) channel Kir3.4, inward rectifier K+ channel KIR3.4, IRK-4, KATP-1, KATP1cardiac ATP-sensitive potassium channel, LQT13, Potassium channel, inwardly rectifying subfamily J member 5, potassium inwardly-rectifying channel, subfamily J, member 5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3762
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KCNJ5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only