Kir3.4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418320	Novus Biologicals NBP18808225UL	25 μL
NBP188082	Novus Biologicals NBP188082	0.1 mL

Description

Kir3.4 Polyclonal specifically detects Kir3.4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kir3.4
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 3762
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Cardiac inward rectifier, CIRKIR3.4, G protein-activated inward rectifier potassium channel 4, GIRK-4, GIRK4Kir3.4, Heart KATP channel, Inward rectifier K(+) channel Kir3.4, inward rectifier K+ channel KIR3.4, IRK-4, KATP-1, KATP1cardiac ATP-sensitive potassium channel, LQT13, Potassium channel, inwardly rectifying subfamily J member 5, potassium inwardly-rectifying channel, subfamily J, member 5
• Gene Symbols: KCNJ5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only