Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25735525UL
Description
KLF6 Polyclonal specifically detects KLF6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
KLF6 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
BCD1Zf9, B-cell-derived protein 1, COPEBCBA1, core promoter element binding protein, Core promoter element-binding protein, CPBPZF9, DKFZp686N0199, EC 2.1.1.43, EC 6.1.1.15, GBF, GC-rich binding factor, GC-rich sites-binding factor GBF, Krueppel-like factor 6, Kruppel-like factor 6, Kruppel-like zinc finger protein Zf9, PAC1, Proto-oncogene BCD1, protooncogene B-cell derived 1, ST12, suppression of tumorigenicity 12 (prostate), Suppressor of tumorigenicity 12 protein, Transcription factor Zf9 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
KLF6 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFN | |
25 μL | |
Prostate Cancer | |
1316 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction