KLF6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP257355	Novus Biologicals NBP257355	100 μL
NB394015	Novus Biologicals NBP25735525UL	25 μL

Description

KLF6 Polyclonal specifically detects KLF6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KLF6
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Prostate Cancer
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1316
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFN
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: BCD1Zf9, B-cell-derived protein 1, COPEBCBA1, core promoter element binding protein, Core promoter element-binding protein, CPBPZF9, DKFZp686N0199, EC 2.1.1.43, EC 6.1.1.15, GBF, GC-rich binding factor, GC-rich sites-binding factor GBF, Krueppel-like factor 6, Kruppel-like factor 6, Kruppel-like zinc finger protein Zf9, PAC1, Proto-oncogene BCD1, protooncogene B-cell derived 1, ST12, suppression of tumorigenicity 12 (prostate), Suppressor of tumorigenicity 12 protein, Transcription factor Zf9
• Gene Symbols: KLF6
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only