Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15742220UL
Description
KLHDC8A Polyclonal specifically detects KLHDC8A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
KLHDC8A | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 4.0-8.0 ug/ml | |
Q8IYD2 | |
KLHDC8A | |
Synthetic peptides corresponding to KLHDC8A (kelch domain containing 8A) The peptide sequence was selected from the C terminal of KLHDC8A. Peptide sequence PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS. | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ10748, kelch domain containing 8A, kelch domain-containing protein 8A | |
Rabbit | |
Protein A purified | |
RUO | |
55220 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction