Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHDC8A Antibody, Novus Biologicals™
SDP

Catalog No. NBP15742220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15742220 20 μL
NBP157422 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15742220 Supplier Novus Biologicals Supplier No. NBP15742220UL

Rabbit Polyclonal Antibody

KLHDC8A Polyclonal specifically detects KLHDC8A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen KLHDC8A
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 4.0-8.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IYD2
Gene Alias FLJ10748, kelch domain containing 8A, kelch domain-containing protein 8A
Gene Symbols KLHDC8A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KLHDC8A (kelch domain containing 8A) The peptide sequence was selected from the C terminal of KLHDC8A. Peptide sequence PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55220
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.