Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHDC8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	KLHDC8A
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15742220 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15742220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP157422 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157422	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

KLHDC8A Polyclonal specifically detects KLHDC8A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	KLHDC8A
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	Q8IYD2
Gene ID (Entrez)	55220
Immunogen	Synthetic peptides corresponding to KLHDC8A (kelch domain containing 8A) The peptide sequence was selected from the C terminal of KLHDC8A. Peptide sequence PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS.
Primary or Secondary	Primary

Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	FLJ10748, kelch domain containing 8A, kelch domain-containing protein 8A
Gene Symbols	KLHDC8A
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

KLHDC8A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents