Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15751220UL
Description
KLHL23 Polyclonal specifically detects KLHL23 in Human samples. It is validated for Western Blot.Specifications
KLHL23 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8NBE8 | |
KLHL23 | |
Synthetic peptides corresponding to KLHL23(kelch-like 23 (Drosophila)) The peptide sequence was selected from the middle region of KLHL23. Peptide sequence TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DITHP, FLJ37812, FLJ41460, kelch-like 23 (Drosophila), kelch-like protein 23, MGC22679, MGC2610 | |
Rabbit | |
Affinity Purified | |
RUO | |
151230 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction