Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | KLHL23 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1575220
![]() |
Novus Biologicals
NBP15751220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157512
![]() |
Novus Biologicals
NBP157512 |
100 μL |
Each for $499.50
|
|
|||||
Description
KLHL23 Polyclonal specifically detects KLHL23 in Human samples. It is validated for Western Blot.Specifications
KLHL23 | |
Polyclonal | |
Rabbit | |
Q8NBE8 | |
151230 | |
Synthetic peptides corresponding to KLHL23(kelch-like 23 (Drosophila)) The peptide sequence was selected from the middle region of KLHL23. Peptide sequence TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DITHP, FLJ37812, FLJ41460, kelch-like 23 (Drosophila), kelch-like protein 23, MGC22679, MGC2610 | |
KLHL23 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title