Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156298
Description
KLHL32 Polyclonal specifically detects KLHL32 in Human samples. It is validated for Western Blot.Specifications
KLHL32 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
BKLHD5, BTB and kelch domain containing 5, BTB and kelch domain-containing protein 5, dJ21F7.1, kelch-like 32 (Drosophila), kelch-like protein 32, KIAA1900RP1-39B17.1, MGC51280, MGC87753, UG0030H05 | |
Rabbit | |
Affinity purified | |
RUO | |
114792 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q96NJ5 | |
KLHL32 | |
Synthetic peptides corresponding to KLHL32(kelch-like 32 (Drosophila)) The peptide sequence was selected from the middle region of KLHL32. Peptide sequence DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Xenopus: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction