KLHL32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156298

Catalog No. NBP156298

Description

KLHL32 Polyclonal specifically detects KLHL32 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KLHL32
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BKLHD5, BTB and kelch domain containing 5, BTB and kelch domain-containing protein 5, dJ21F7.1, kelch-like 32 (Drosophila), kelch-like protein 32, KIAA1900RP1-39B17.1, MGC51280, MGC87753, UG0030H05
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114792
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96NJ5
• Gene Symbols: KLHL32
• Immunogen: Synthetic peptides corresponding to KLHL32(kelch-like 32 (Drosophila)) The peptide sequence was selected from the middle region of KLHL32. Peptide sequence DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Xenopus: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG