Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KLHL32 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KLHL32 Polyclonal specifically detects KLHL32 in Human samples. It is validated for Western Blot.Specifications
KLHL32 | |
Polyclonal | |
Rabbit | |
Q96NJ5 | |
114792 | |
Synthetic peptides corresponding to KLHL32(kelch-like 32 (Drosophila)) The peptide sequence was selected from the middle region of KLHL32. Peptide sequence DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BKLHD5, BTB and kelch domain containing 5, BTB and kelch domain-containing protein 5, dJ21F7.1, kelch-like 32 (Drosophila), kelch-like protein 32, KIAA1900RP1-39B17.1, MGC51280, MGC87753, UG0030H05 | |
KLHL32 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title