Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | KLHL9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1550920
![]() |
Novus Biologicals
NBP15509120UL |
20 μL |
Each for $206.00
|
|
|||||
NBP155091
![]() |
Novus Biologicals
NBP155091 |
100 μL |
Each for $487.50
|
|
|||||
Description
KLHL9 Polyclonal specifically detects KLHL9 in Human samples. It is validated for Western Blot.Specifications
KLHL9 | |
Polyclonal | |
Rabbit | |
Q9P2J3 | |
55958 | |
Synthetic peptides corresponding to KLHL9(kelch-like 9 (Drosophila)) The peptide sequence was selected from the middle region of KLHL9. Peptide sequence SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ13568, FLJ21815, kelch-like 9 (Drosophila), kelch-like protein 9, KIAA1354 | |
KLHL9 | |
IgG | |
69 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title