Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | KLHL9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155091
![]() |
Novus Biologicals
NBP155091 |
100 μL |
Each for $480.74
|
|
|||||
NBP1550920
![]() |
Novus Biologicals
NBP15509120UL |
20 μL | N/A | N/A | N/A | ||||
Description
KLHL9 Polyclonal specifically detects KLHL9 in Human samples. It is validated for Western Blot.Specifications
| KLHL9 | |
| Polyclonal | |
| Rabbit | |
| Q9P2J3 | |
| 55958 | |
| Synthetic peptides corresponding to KLHL9(kelch-like 9 (Drosophila)) The peptide sequence was selected from the middle region of KLHL9. Peptide sequence SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ13568, FLJ21815, kelch-like 9 (Drosophila), kelch-like protein 9, KIAA1354 | |
| KLHL9 | |
| IgG | |
| 69 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title