Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15509120UL
Description
KLHL9 Polyclonal specifically detects KLHL9 in Human samples. It is validated for Western Blot.Specifications
KLHL9 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9P2J3 | |
KLHL9 | |
Synthetic peptides corresponding to KLHL9(kelch-like 9 (Drosophila)) The peptide sequence was selected from the middle region of KLHL9. Peptide sequence SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY. | |
Affinity Purified | |
RUO | |
55958 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ13568, FLJ21815, kelch-like 9 (Drosophila), kelch-like protein 9, KIAA1354 | |
Rabbit | |
69 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction