Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Klkbl4 Antibody, Novus Biologicals™

Klkbl4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15761720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15761720 20 μL
NBP157617 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15761720 Supplier Novus Biologicals Supplier No. NBP15761720UL

Description

Rabbit Polyclonal Antibody

Klkbl4 Polyclonal specifically detects Klkbl4 in Human samples. It is validated for Western Blot.

Specifications

Antigen Klkbl4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6PEW0
Gene Alias Cancer/testis antigen 67, CT67Plasma kallikrein-like protein 4, FLJ25339, KLKBL4inactive serine protease 54, protease, serine, 54
Gene Symbols PRSS54
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KLKBL4 The peptide sequence was selected from the C terminal of KLKBL4 (NP_001073961). Peptide sequence EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 221191
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.