KLRA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159032

Catalog No. NBP159032

Description

KLRA1 Polyclonal specifically detects KLRA1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KLRA1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UNG0
• Gene Symbols: KLRA1P
• Immunogen: Synthetic peptides corresponding to KLRA1(killer cell lectin-like receptor subfamily A, member 1) The peptide sequence was selected from the N terminal of KLRA1. Peptide sequence NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 92%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: killer cell lectin-like receptor subfamily A pseudogene 1, KLRA#, KLRA1, Ly49, Ly-49L, LY49L, MGC126520, MGC126522
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10748
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.