Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KMT2A/MLL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25523725UL
Description
KMT2A/MLL Polyclonal specifically detects KMT2A/MLL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
KMT2A/MLL | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
ALL1, ALL-1MLL/GAS7, CXXC7TET1-MLL, CXXC-type zinc finger protein 7, EC 2.1.1.43, HRXFLJ11783, HTRX, HTRX1MLL-AF4 der(11) fusion protein, KMT2ACDK6/MLL fusion protein, Lysine N-methyltransferase 2A, MLL/GAS7 fusion protein, MLL/GMPS fusion protein, MLL1, MLL1A, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog), myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), Trithorax-like protein, TRX1histone-lysine N-methyltransferase MLL, Zinc finger protein HRX | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MLL | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED | |
25 μL | |
Transcription Factors and Regulators | |
4297 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction