KMT2A/MLL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255237

Catalog No. NBP255237

Description

KMT2A/MLL Polyclonal specifically detects KMT2A/MLL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: KMT2A/MLL
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ALL1, ALL-1MLL/GAS7, CXXC7TET1-MLL, CXXC-type zinc finger protein 7, EC 2.1.1.43, HRXFLJ11783, HTRX, HTRX1MLL-AF4 der(11) fusion protein, KMT2ACDK6/MLL fusion protein, Lysine N-methyltransferase 2A, MLL/GAS7 fusion protein, MLL/GMPS fusion protein, MLL1, MLL1A, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog), myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), Trithorax-like protein, TRX1histone-lysine N-methyltransferase MLL, Zinc finger protein HRX
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MLL
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED
• Quantity: 100 μL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 4297
• Target Species: Human
• Isotype: IgG

For Research Use Only