Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KOX8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179391
Description
KOX8 Polyclonal specifically detects KOX8 in Human samples. It is validated for Western Blot.Specifications
KOX8 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686L10267, FLJ16755, FLJ46310, KOX8, zinc finger protein 15, zinc finger protein 15-like 1 (KOX 8), zinc finger protein 708, zinc finger protein KOX8, ZNF15, ZNF15L1 | |
Rabbit | |
Affinity purified | |
RUO | |
7562 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_067092 | |
ZNF708 | |
Synthetic peptide directed towards the N terminal of human ZNF708. Peptide sequence KYVKVFHKYSNAKRHKIRHTGKNPFKCKECGKSFCMLSQLTQHEIIHTGE. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%. | |
Human, Equine | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction