Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KOX8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KOX8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KOX8 Polyclonal specifically detects KOX8 in Human samples. It is validated for Western Blot.Specifications
KOX8 | |
Polyclonal | |
Rabbit | |
NP_067092 | |
7562 | |
Synthetic peptide directed towards the N terminal of human ZNF708. Peptide sequence KYVKVFHKYSNAKRHKIRHTGKNPFKCKECGKSFCMLSQLTQHEIIHTGE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686L10267, FLJ16755, FLJ46310, KOX8, zinc finger protein 15, zinc finger protein 15-like 1 (KOX 8), zinc finger protein 708, zinc finger protein KOX8, ZNF15, ZNF15L1 | |
ZNF708 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title