KOX8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179392

Catalog No. NBP179392

Description

KOX8 Polyclonal specifically detects KOX8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KOX8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686L10267, FLJ16755, FLJ46310, KOX8, zinc finger protein 15, zinc finger protein 15-like 1 (KOX 8), zinc finger protein 708, zinc finger protein KOX8, ZNF15, ZNF15L1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7562
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: EAW84891
• Gene Symbols: ZNF708
• Immunogen: Synthetic peptide directed towards the C terminal of human ZNF708. Peptide sequence ILTKHKVIHTEDKPYKCEECGKTFNYSSNFTNHKKIHTGEKPYKCEECGK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Fruit fly: 90%; Rat: 90%; Crab-eating macaque: 78%; Chimpanzee: 76%; Sumatran orangutan: 76%; Bovine: 76%; African malaria mosquito: 76%.
• Target Species: Human, Bovine, Equine, Rabbit, Zebrafish
• Isotype: IgG