Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KRT81 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25713325UL
Description
KRT81 Polyclonal specifically detects KRT81 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
KRT81 | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
ghHb1, ghHkb1, Hair keratin K2.9, hard keratin, type II, 1, Hb-1, hHAKB2-1, K81, keratin 81, Keratin, hair, basic, 1MLN 137, keratin, type II cuticular Hb1, Keratin-81, KRTHB1HB1, Metastatic lymph node 137 gene protein, MLN137, Type II hair keratin Hb1, Type-II keratin Kb21 | |
Rabbit | |
Affinity Purified | |
RUO | |
3887 | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
KRT81 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AESWYRSKCEEMKATVIRHGETLRRTKEEINELN | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction