KRT81 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25713325UL

Catalog No. NB403537

Description

KRT81 Polyclonal specifically detects KRT81 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KRT81
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ghHb1, ghHkb1, Hair keratin K2.9, hard keratin, type II, 1, Hb-1, hHAKB2-1, K81, keratin 81, Keratin, hair, basic, 1MLN 137, keratin, type II cuticular Hb1, Keratin-81, KRTHB1HB1, Metastatic lymph node 137 gene protein, MLN137, Type II hair keratin Hb1, Type-II keratin Kb21
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3887
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KRT81
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only