Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KRT81 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	KRT81
Dilution	Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP257133 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP257133	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB403537 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25713325UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

KRT81 Polyclonal specifically detects KRT81 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	KRT81
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	ghHb1, ghHkb1, Hair keratin K2.9, hard keratin, type II, 1, Hb-1, hHAKB2-1, K81, keratin 81, Keratin, hair, basic, 1MLN 137, keratin, type II cuticular Hb1, Keratin-81, KRTHB1HB1, Metastatic lymph node 137 gene protein, MLN137, Type II hair keratin Hb1, Type-II keratin Kb21
Gene Symbols	KRT81
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Immunohistochemistry-Paraffin 1:500 - 1:1000
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	3887
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AESWYRSKCEEMKATVIRHGETLRRTKEEINELN
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

KRT81 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents