KRTAP1-5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179847

Catalog No. NBP179847

Description

KRTAP1-5 Polyclonal specifically detects KRTAP1-5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KRTAP1-5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KAP1.5High sulfur keratin-associated protein 1.5, keratin associated protein 1.5, keratin associated protein 1-5, Keratin-associated protein 1.5, keratin-associated protein 1-5, KRTAP1.5, KRTAP-15, MGC126604
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Goat, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_114163
• Gene Symbols: KRTAP1-5
• Immunogen: Synthetic peptide directed towards the C terminal of human KRTAP1-5The immunogen for this antibody is KRTAP1-5. Peptide sequence TGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83895
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.