Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KRTAP1-5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | KRTAP1-5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17984720
![]() |
Novus Biologicals
NBP17984720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179847
![]() |
Novus Biologicals
NBP179847 |
100 μL |
Each for $499.50
|
|
|||||
Description
KRTAP1-5 Polyclonal specifically detects KRTAP1-5 in Human samples. It is validated for Western Blot.Specifications
KRTAP1-5 | |
Polyclonal | |
Rabbit | |
NP_114163 | |
83895 | |
Synthetic peptide directed towards the C terminal of human KRTAP1-5The immunogen for this antibody is KRTAP1-5. Peptide sequence TGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KAP1.5High sulfur keratin-associated protein 1.5, keratin associated protein 1.5, keratin associated protein 1-5, Keratin-associated protein 1.5, keratin-associated protein 1-5, KRTAP1.5, KRTAP-15, MGC126604 | |
KRTAP1-5 | |
IgG | |
18 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title