KRTAP11-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25556425UL

Catalog No. NB394941

Description

KRTAP11-1 Polyclonal specifically detects KRTAP11-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KRTAP11-1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: HACL1, HACL-1, high sulfur keratin-associated protein 11.1, KAP11.1, keratin associated protein 11-1, keratin-associated protein 11-1, KRTAP11.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 337880
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KRTAP11-1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QETCCEPTACQPTCYRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVS
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only