Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ku70/XRCC6 Antibody, Novus Biologicals™

Ku70/XRCC6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP238567 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238567 0.1 mL
NB396760 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238567 Supplier Novus Biologicals Supplier No. NBP238567
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Ku70/XRCC6 Polyclonal specifically detects Ku70/XRCC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Ku70/XRCC6
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P12956
Gene Alias 5'-deoxyribose-5-phosphate lyase Ku70, 5'-dRP lyase Ku70, 70 kDa subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70 kDa subunit, CTC box binding factor 75 kDa subunit, CTC box-binding factor 75 kDa subunit, CTC75, CTCBF, D22S731, EC 3.6.4.-, EC 4.2.99.-, G22P1Ku70, Ku autoantigen p70 subunit, Ku autoantigen, 70kDa, KU70, ML8,70 kDa subunit, Thyroid-lupus autoantigen, thyroid-lupus autoantigen p70, TLAAD22S671, X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6, X-ray repair cross-complementing protein 6
Gene Symbols XRCC6
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining
Primary or Secondary Primary
Gene ID (Entrez) 2547
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.