Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Kv1.4 Antibody, Novus Biologicals™

Kv1.4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP189691 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP189691 0.1 mL
NB405845 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP189691 Supplier Novus Biologicals Supplier No. NBP189691
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Kv1.4 Polyclonal specifically detects Kv1.4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Kv1.4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias cardiac potassium channel, fetal skeletal muscle potassium channel, HBK4, HK1, HPCN2HUKII, KCNA4L, KCNA8, Kv1.4, PCN2, potassium channel 2, potassium voltage-gated channel subfamily A member 4, potassium voltage-gated channel, shaker-related subfamily, member 4, potassium voltage-gated channel, shaker-related subfamily, member 4-like, rapidly inactivating potassium channel, shaker-related potassium channel Kv1.4, type A potassium channel, Voltage-gated K(+) channel HuKII, Voltage-gated potassium channel HBK4, Voltage-gated potassium channel HK1, Voltage-gated potassium channel subunit Kv1.4
Gene Symbols KCNA4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3739
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.