Kv1.6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324946

Catalog No. NB301506

Description

Kv1.6 Polyclonal antibody specifically detects Kv1.6 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Kv1.6
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: FLJ25134, HBK2, human brain potassium channel-2, KV1.6, potassium voltage-gated channel subfamily A member 6, potassium voltage-gated channel, shaker-related subfamily, member 6, Voltage-gated potassium channel HBK2, voltage-gated potassium channel protein Kv1.6, Voltage-gated potassium channel subunit Kv1.6
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Kv1.6 using the following amino acid sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 3742
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified