Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301506

Kv1.6 Antibody, Novus Biologicals™
SDP

Catalog No. NB301506 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301506 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301506 Supplier Novus Biologicals Supplier No. NBP324946
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Kv1.6 Polyclonal antibody specifically detects Kv1.6 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen Kv1.6
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias FLJ25134, HBK2, human brain potassium channel-2, KV1.6, potassium voltage-gated channel subfamily A member 6, potassium voltage-gated channel, shaker-related subfamily, member 6, Voltage-gated potassium channel HBK2, voltage-gated potassium channel protein Kv1.6, Voltage-gated potassium channel subunit Kv1.6
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein Kv1.6 using the following amino acid sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3742
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.