Kv11.2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31787525UL

Catalog No. NB159781

Description

Kv11.2 Polyclonal antibody specifically detects Kv11.2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Kv11.2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: eag related protein 2, eag-related gene member 2, Eag-related protein 2, erg2, ERG-2, ether-a-go-go related gene potassium channel 2, Ether-a-go-go-related gene potassium channel 2, Ether-a-go-go-related protein 2, hERG-2, HERG2, Kv11.2, potassium voltage-gated channel subfamily H member 6, potassium voltage-gated channel, subfamily H (eag-related), member 6, Voltage-gated potassium channel subunit Kv11.2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
• Quantity: 25 μg
• Research Discipline: Neuroscience
• Gene ID (Entrez): 81033
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified