Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kv4.1 Antibody, Novus Biologicals™
SDP

Catalog No. NB035327 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB035327 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB035327 Supplier Novus Biologicals Supplier No. NBP287705
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Kv4.1 Polyclonal specifically detects Kv4.1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Kv4.1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose
Gene Alias Kv4.1, potassium voltage-gated channel subfamily D member 1, potassium voltage-gated channel, Shal-related subfamily, member 1, shal-type potassium channel, voltage-gated potassium channel Kv4.1, Voltage-gated potassium channel subunit Kv4.1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human Kv4.1. Peptide sequence: SRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGR The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3750
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.