Kv7.3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174102

Catalog No. NBP174102

Description

Kv7.3 Polyclonal specifically detects Kv7.3 in Mouse, Hamster samples. It is validated for Western Blot.

Specifications

• Antigen: Kv7.3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BFNC2, EBN2, KQT-like 3, KV7.3, Potassium channel subunit alpha KvLQT3, potassium channel, voltage-gated, subfamily Q, member 3, potassium voltage-gated channel subfamily KQT member 3, potassium voltage-gated channel, KQT-like subfamily, member 3, Voltage-gated potassium channel subunit Kv7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 92%; Rat: 92%; Guinea pig: 85%; Equine: 85%; Pig: 85%; Rabbit: 85%; Bovine: 78%; Canine: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Chinese Hamster, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8K3F6
• Gene Symbols: KCNQ3
• Immunogen: Synthetic peptides corresponding to the middle region of Kv7.3. Immunizing peptide sequence: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 3786
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.