Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Kv7.3 Antibody, Novus Biologicals™

Kv7.3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17410220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17410220 20 μL
NBP174102 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17410220 Supplier Novus Biologicals Supplier No. NBP17410220UL

Description

Rabbit Polyclonal Antibody

Kv7.3 Polyclonal specifically detects Kv7.3 in Mouse, Hamster samples. It is validated for Western Blot.

Specifications

Antigen Kv7.3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q8K3F6
Gene Alias BFNC2, EBN2, KQT-like 3, KV7.3, Potassium channel subunit alpha KvLQT3, potassium channel, voltage-gated, subfamily Q, member 3, potassium voltage-gated channel subfamily KQT member 3, potassium voltage-gated channel, KQT-like subfamily, member 3, Voltage-gated potassium channel subunit Kv7.3
Gene Symbols KCNQ3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the middle region of Kv7.3. Immunizing peptide sequence TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3786
Target Species Mouse, Chinese Hamster
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.