Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LACC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | LACC1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179523
![]() |
Novus Biologicals
NBP179523 |
100 μL |
Each for $480.74
|
|
|||||
NBP17952320
![]() |
Novus Biologicals
NBP17952320UL |
20 μL | N/A | N/A | N/A | ||||
Description
LACC1 Polyclonal specifically detects LACC1 in Mouse samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| LACC1 | |
| Unconjugated | |
| RUO | |
| chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811 | |
| LACC1 | |
| IgG | |
| 47 kDa |
| Polyclonal | |
| Rabbit | |
| NP_766076 | |
| 144811 | |
| The specific Immunogen is proprietary information. Peptide sequence LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title