Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LACC1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen LACC1
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
Regulatory Status RUO
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17952320
View Documents
Novus Biologicals
NBP17952320UL
20 μL
Each for $152.22
Add to cart
 
NBP179523
View Documents
Novus Biologicals
NBP179523
100 μL
Each for $436.00
Add to cart
 
Description

Description

LACC1 Polyclonal specifically detects LACC1 in Mouse samples. It is validated for Western Blot, Immunoprecipitation.
Specifications

Specifications

LACC1
Unconjugated
RUO
NP_766076
144811
The specific Immunogen is proprietary information. Peptide sequence LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811
LACC1
IgG
Affinity Purified
47 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit