Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LACC1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | LACC1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17952320
|
Novus Biologicals
NBP17952320UL |
20 μL |
Each for $152.22
|
|
NBP179523
|
Novus Biologicals
NBP179523 |
100 μL |
Each for $436.00
|
|
Description
LACC1 Polyclonal specifically detects LACC1 in Mouse samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| LACC1 | |
| Unconjugated | |
| RUO | |
| NP_766076 | |
| 144811 | |
| The specific Immunogen is proprietary information. Peptide sequence LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811 | |
| LACC1 | |
| IgG | |
| Affinity Purified | |
| 47 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title