Lactate Dehydrogenase B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155415

Catalog No. NBP155415

Description

Lactate Dehydrogenase B Polyclonal specifically detects Lactate Dehydrogenase B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Lactate Dehydrogenase B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.1.1, EC 1.1.1.27, lactate dehydrogenase B, LDH heart subunit, LDH-B, LDH-H, L-lactate dehydrogenase B chain, Renal carcinoma antigen NY-REN-46, TRG-5
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Research Discipline: HIF Target Genes, Hypoxia
• Gene ID (Entrez): 3945
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:2000, Immunoprecipitation, Immunohistochemistry-Paraffin
• Gene Accession No.: P07195
• Gene Symbols: LDHB
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lactate Dehydrogenase B. Peptide Sequence MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD. The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only