Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lactate Dehydrogenase C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Lactate Dehydrogenase C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15479820
|
Novus Biologicals
NBP15479820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP154798
|
Novus Biologicals
NBP154798 |
100 μL |
Each for $487.50
|
|
|||||
Description
Lactate Dehydrogenase C Polyclonal specifically detects Lactate Dehydrogenase C in Human samples. It is validated for Western Blot.Specifications
| Lactate Dehydrogenase C | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers | |
| Cancer/testis antigen 32, CT32EC 1.1.1.27, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain | |
| LDHC | |
| IgG | |
| 36 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P07864 | |
| 3948 | |
| Synthetic peptides corresponding to LDHC(lactate dehydrogenase C) The peptide sequence was selected from the middle region of LDHC. Peptide sequence IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title