Lactate Dehydrogenase C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15479820UL

Catalog No. NBP15479820

Description

Lactate Dehydrogenase C Polyclonal specifically detects Lactate Dehydrogenase C in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Lactate Dehydrogenase C
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P07864
• Gene Symbols: LDHC
• Immunogen: Synthetic peptides corresponding to LDHC(lactate dehydrogenase C) The peptide sequence was selected from the middle region of LDHC. Peptide sequence IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cancer/testis antigen 32, CT32EC 1.1.1.27, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 20 μL
• Research Discipline: Cellular Markers
• Gene ID (Entrez): 3948
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.