Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Lactate Dehydrogenase C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP15479820UL

View more versions of this product

Catalog No. NBP15479820

$206.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

Lactate Dehydrogenase C Polyclonal specifically detects Lactate Dehydrogenase C in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Lactate Dehydrogenase C
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000
Gene Accession No.	P07864
Gene Symbols	LDHC
Immunogen	Synthetic peptides corresponding to LDHC(lactate dehydrogenase C) The peptide sequence was selected from the middle region of LDHC. Peptide sequence IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV.
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Mouse
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	Cancer/testis antigen 32, CT32EC 1.1.1.27, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain
Host Species	Rabbit
Molecular Weight of Antigen	36 kDa
Quantity	20 μL
Research Discipline	Cellular Markers
Gene ID (Entrez)	3948
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Lactate Dehydrogenase C Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions