Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Lambda5/IGLL1 Antibody, Novus Biologicals™

Lambda5/IGLL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158333 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158333 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158333 Supplier Novus Biologicals Supplier No. NBP158333
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Lambda5/IGLL1 Polyclonal specifically detects Lambda5/IGLL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Lambda5/IGLL1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P15814
Gene Alias 14.1, AGM2, CD179 antigen-like family member B, CD179b, CD179b antigen, Ig lambda-5, IGL1, IGL5CD179B, IGLJ14.1, IGLL, IGO, IGVPB, immunoglobulin lambda-like polypeptide 1, Immunoglobulin omega polypeptide, immunoglobulin omega polypeptide chain, immunoglobulin-related 14.1 protein, Immunoglobulin-related protein 14.1, lambda5, Pre-B lymphocyte-specific protein-2, VPREB2
Gene Symbols IGLL1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to IGLL1(immunoglobulin lambda-like polypeptide 1) The peptide sequence was selected from the N terminal of IGLL1. Peptide sequence RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3543
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.