Lambda5/IGLL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158333

Catalog No. NBP158333

Description

Lambda5/IGLL1 Polyclonal specifically detects Lambda5/IGLL1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Lambda5/IGLL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 14.1, AGM2, CD179 antigen-like family member B, CD179b, CD179b antigen, Ig lambda-5, IGL1, IGL5CD179B, IGLJ14.1, IGLL, IGO, IGVPB, immunoglobulin lambda-like polypeptide 1, Immunoglobulin omega polypeptide, immunoglobulin omega polypeptide chain, immunoglobulin-related 14.1 protein, Immunoglobulin-related protein 14.1, lambda5, Pre-B lymphocyte-specific protein-2, VPREB2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P15814
• Gene Symbols: IGLL1
• Immunogen: Synthetic peptides corresponding to IGLL1(immunoglobulin lambda-like polypeptide 1) The peptide sequence was selected from the N terminal of IGLL1. Peptide sequence RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT.
• Quantity: 100 μL
• Research Discipline: Immunology
• Gene ID (Entrez): 3543
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG