Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lambda5/IGLL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Lambda5/IGLL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Lambda5/IGLL1 Polyclonal specifically detects Lambda5/IGLL1 in Human samples. It is validated for Western Blot.Specifications
| Lambda5/IGLL1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| P15814 | |
| 3543 | |
| Synthetic peptides corresponding to IGLL1(immunoglobulin lambda-like polypeptide 1) The peptide sequence was selected from the N terminal of IGLL1. Peptide sequence RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 14.1, AGM2, CD179 antigen-like family member B, CD179b, CD179b antigen, Ig lambda-5, IGL1, IGL5CD179B, IGLJ14.1, IGLL, IGO, IGVPB, immunoglobulin lambda-like polypeptide 1, Immunoglobulin omega polypeptide, immunoglobulin omega polypeptide chain, immunoglobulin-related 14.1 protein, Immunoglobulin-related protein 14.1, lambda5, Pre-B lymphocyte-specific protein-2, VPREB2 | |
| IGLL1 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title