Lamin B Receptor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159845

Catalog No. NBP159845

Description

Lamin B Receptor Polyclonal specifically detects Lamin B Receptor in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: Lamin B Receptor
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DHCR14B, FLJ43126, Integral nuclear envelope inner membrane protein, lamin B receptor, lamin-B receptor, LMN2R, MGC9041, PHA
• Host Species: Rabbit
• Molecular Weight of Antigen: 71 kDa
• Quantity: 100 μL
• Research Discipline: Cellular Signaling
• Gene ID (Entrez): 3930
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: Q14739
• Gene Symbols: LBR
• Immunogen: Synthetic peptides corresponding to LBR (lamin B receptor) The peptide sequence was selected from the middle region of LBR)(50ug). Peptide sequence GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Yeast 77%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG