Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lamin B Receptor Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Lamin B Receptor |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159845
|
Novus Biologicals
NBP159845 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15984520
|
Novus Biologicals
NBP15984520UL |
20 μL | N/A | N/A | N/A | ||||
Description
Lamin B Receptor Polyclonal specifically detects Lamin B Receptor in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| Lamin B Receptor | |
| Unconjugated | |
| RUO | |
| DHCR14B, FLJ43126, Integral nuclear envelope inner membrane protein, lamin B receptor, lamin-B receptor, LMN2R, MGC9041, PHA | |
| LBR | |
| IgG | |
| 71 kDa |
| Polyclonal | |
| Rabbit | |
| Q14739 | |
| 3930 | |
| Synthetic peptides corresponding to LBR (lamin B receptor) The peptide sequence was selected from the middle region of LBR)(50ug). Peptide sequence GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title